tcna6710 HuD Antibody / ELAVL4

Data sheet

Download PDF Datasheet

Technical Inquries

Submit Review

Product Description

HuD, otherwise known as ELAV-like protein 4 or PNEM, is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is anRNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. And HuD is expressed only in neurons and it binds toAU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Also, HuD is important in neurons during brain development and plasticity.

Information

ApplicationWB, IHC-P
Species ReactivityHuman, Mouse, Rat
Host SpeciesRabbit
Immunogen / Amino acidsAmino acids MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK of human ELAVL4/HuD were used as the immunogen for the HuD antibody.
ConjugationAntigen affinity purified
ClonalityPolyclonal
IsotypeRabbit IgG

Specifications

FormLyophilized powder
Storage Buffer0.5mg/ml if reconstituted with 0.2ml sterile DI water
Recommended DilutionWestern blot: 0.1-0.5ug/ml
IHC (Paraffin): 0.5-1ug/mlOptimal dilution of the HuD antibody should be determined by the researcher.

Misc Information

Storage InstructionAfter reconstitution, the HuD antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
SwissProtP26378
ReferencesAntigen affinity purified
Get valuable resources and offers directly to your email.